Analytical Data
-
Gene name
GDPD3
- Application
-
Alternative Names
FLJ22603; GDPD 3; GDPD3; GDPD3_HUMAN; Glycerophosphodiester phosphodiesterase domain containing 3; Glycerophosphodiester phosphodiesterase domain-containing protein 3; MGC4171
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7L5L3
-
Expression Region
1-256aa
-
AA Sequence
MAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS
-
Molecular Weight
56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GDPD3, or glycerol-3-phosphate dehydrogenase domain-containing protein 3, is a member of the glycerol-3-phosphate dehydrogenase (GPD) family, which plays a crucial role in lipid metabolism and energy production. Research on GDPD3 has gained momentum due to its potential implications in various physiological and pathological processes, including cellular differentiation, cancer progression, and metabolic disorders. Emerging studies suggest that GDPD3 serves not only as an enzyme involved in the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate but also as a regulatory protein that may influence cell signaling pathways. The importance of lipids in cellular functions has underscored the need to understand the role of GDPD3 in diseases, particularly in the context of obesity and diabetes, where lipid metabolism is disrupted. Additionally, researchers are investigating the post-translational modifications and interactions of GDPD3 with other cellular proteins, which could elucidate its functional significance and potential as a therapeutic target. Overall, the study of GDPD3 is an exciting area of research that bridges metabolism, cell biology, and disease, highlighting its potential as a biomarker and a target for novel therapeutic approaches.











