Analytical Data
-
Gene name
GJB7
- Application
-
Alternative Names
GJB7; CX25; Gap junction beta-7 protein; Connexin-25; Cx25
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PEY0
-
Expression Region
1-233aa
-
AA Sequence
MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSVMSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV
-
Molecular Weight
52.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GJB7, also known as Gap Junction Protein Beta 7, is a member of the connexin family, which plays a crucial role in forming gap junctions that facilitate intercellular communication. This protein is particularly important in the development and function of various tissues, including the cochlea in the inner ear, where it contributes to the maintenance of homeostasis and cellular communication vital for hearing. Mutations in the GJB7 gene have been linked to certain types of hearing loss, highlighting its significance in auditory biology. The study of GJB7 recombinant protein aims to explore its structure, function, and interaction with other cellular components, which is essential for understanding the molecular mechanisms underlying its role in cell signaling and connectivity. Additionally, GJB7 recombinant protein research holds potential therapeutic implications, as it could lead to the development of innovative treatments for hearing impairments associated with GJB7 mutations. By investigating the protein's properties, researchers can better understand its role in disease and potentially pave the way for targeted gene therapies or protein-based interventions in auditory disorders. Understanding GJB7 not only enhances the knowledge of gap junction biology but also underscores the intricate relationships between genetic factors and sensory functions, providing insights that could benefit broader areas of study in cell biology and medicine.
