Analytical Data
-
Gene name
GIYD2
- Application
-
Alternative Names
GIY YIG domain containing protein 1; GIY-YIG domain-containing protein 1; GIYD 1; GIYD 2; GIYD1; GIYD2; SLX 1; SLX1; SLX1 structure-specific endonuclease subunit homolog A (S. cerevisiae); SLX1 structure-specific endonuclease subunit homolog B (S. cerevisiae); SLX1_HUMAN; SLX1A; Slx1b; structure specific endonuclease subunit SLX1; Structure-specific endonuclease subunit SLX1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQ83
-
Expression Region
1-275aa
-
AA Sequence
MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
-
Molecular Weight
57.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the GIYD2 recombinant protein has gained attention due to its potential implications in various biological processes and health-related applications. GIYD2, part of the GTP-binding YchF family, is thought to play a significant role in cellular functions such as stress response, apoptosis, and regulation of immune responses. As a newly identified protein, its exact mechanisms and interactions remain largely unknown, presenting an intriguing area for research. The recombinant expression of GIYD2 allows for detailed studies of its structure and function, providing insights into its biological significance. By employing techniques such as molecular cloning, protein purification, and characterization through biophysical methods, researchers aim to elucidate the protein's role in cellular pathways. Additionally, understanding GIYD2's function could pave the way for therapeutic advancements, especially in diseases where its regulatory functions may be disrupted. Given the rising interest in personalized medicine, investigations into GIYD2 could contribute to the development of novel treatments targeting specific cellular mechanisms. As research progresses, the GIYD2 recombinant protein stands as a promising candidate for exploring new dimensions in cell biology and therapeutic strategies.
