Analytical Data
-
Gene name
GATS
- Application
-
Alternative Names
CASTOR3; GATS; STAG3OSPutative protein CASTOR 3; STAG3 opposite strand transcript protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NAP1
-
Expression Region
1-163aa
-
AA Sequence
MSCRGRGAGGRWNSTSWSTGCKLPASPRRVSRCSPTGLIKLAFLFSKTRCKFFSLTETPEDYTIIVDEEGFLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGMTKIAKSVIAPLADQNISVFMLSTYQTDFILVLKRDLPFVTHTLSSEFTILWSVARL
-
Molecular Weight
44.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GATS (Glutamate Amino Transferase) represents a crucial enzyme in various biological processes, particularly in amino acid metabolism and neurotransmitter synthesis. The rising interest in GATS has been driven by its potential implications in neurobiology, metabolic disorders, and therapeutic applications. Research into GATS recombinant proteins has gained momentum due to advancements in molecular biology techniques, enabling the expression and purification of these proteins for functional studies. Understanding the structure and function of GATS can reveal insights into its role in fundamental metabolic pathways and its involvement in diseases such as Alzheimer's and other neurodegenerative disorders. Additionally, recombinant GATS proteins provide a valuable tool for drug development, as they can be utilized in high-throughput screening to identify potential inhibitors or modulators. The characterization of GATS also paves the way for biotechnological applications and the development of novel therapeutic strategies. Consequently, the study of GATS recombinant proteins holds great promise for enhancing our understanding of both basic and applied biological sciences.
