Cat: PA2000-7884

Recombinant Human GAGE1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GAGE1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GAGE1; G antigen 1; GAGE-1; Antigen MZ2-F; Cancer/testis antigen 4.1; CT4.1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0DTW1

  • Expression Region

    1-139aa

  • AA Sequence

    MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GAGE1 (G antigen 1) is a member of the GAGE family of cancer/testis antigens, which are primarily expressed in male germ cells and various tumors but are generally absent in normal adult tissues, making them promising targets for cancer immunotherapy. The interest in GAGE1 arises from its unique expression pattern, as it elicited an immune response in cancer patients, indicating its potential as a biomarker for tumor presence and progression. Studies have shown that GAGE1 can be recognized by the immune system, thus serving as a candidate for the development of vaccines and other immunotherapeutic strategies aimed at eliciting robust anti-tumor responses. The ability to produce recombinant GAGE1 protein allows researchers to further investigate its immunogenic properties, potential roles in cancer biology, and applications in immunotherapy. This protein can be utilized for the development of diagnostic tools and therapeutic interventions, driving research that enhances our understanding of tumor immunology and the mechanisms by which tumors evade immune recognition. As efforts continue to elucidate the precise functions and pathways associated with GAGE1, its role as a valuable tool in the fight against cancer becomes increasingly apparent, paving the way for innovative treatment modalities that leverage the body's immune system to combat malignancies effectively.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US