Analytical Data
-
Gene name
GAGE12B
- Application
-
Alternative Names
GAGE12B;; GAGE12C;; GAGE12D;; GAGE12EG antigen 12B/C/D/E; GAGE-12B; GAGE-12C; GAGE-12D; GAGE-12E
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1L429
-
Expression Region
1-117aa
-
AA Sequence
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
-
Molecular Weight
39.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GAGE12B is a member of the GAGE family of genes, which are known for their expression in various types of tumors but are largely silent in normal adult tissues. These genes encode for proteins that are implicated in tumorigenesis and immune evasion, making them of significant interest in cancer research. The GAGE proteins have been identified as potential cancer/testis (CT) antigens, which are typically expressed in male germ cells and various cancers. The study of GAGE12B is particularly relevant due to its possible role in eliciting anti-tumor immune responses, as they may serve as targets for cancer immunotherapy. Research has shown that these proteins can induce T-cell responses in cancer patients, suggesting their potential as candidates for therapeutic applications such as vaccine development. Moreover, understanding the structural and functional properties of GAGE12B can provide insights into its mechanism of action in malignant cells and the immune system's recognition of tumor antigens. The exploration of GAGE12B’s role in cancer biology could lead to innovative strategies for diagnosis and treatment, harnessing the body’s immune response to effectively combat tumors where GAGE12B is aberrantly expressed. As a result, ongoing investigations into GAGE12B and its reconstituted protein forms aim to clarify its involvement in tumor immunity and advance the field of targeted cancer therapies.
