Analytical Data
-
Gene name
APOL1
- Application
-
Alternative Names
APOL1;APOL;ApolipoProtein L1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14791
-
Expression Region
1-238aa
-
AA Sequence
MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSK PLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAA AELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSE LEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFT EGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA
-
Molecular Weight
52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
APOL1 (Apolipoprotein L1) is a gene that encodes a protein associated with kidney function and susceptibility to kidney diseases, particularly in populations of African descent. Its role became prominent when differential alleles of APOL1 were identified, with variants G1 and G2 linked to a higher risk of focal segmental glomerulosclerosis (FSGS) and hypertension-attributed end-stage renal disease (ESRD). Research has indicated that these APOL1 variants confer a protective effect against certain infections, like sleeping sickness caused by the parasite Trypanosoma brucei, highlighting an evolutionary trade-off between resilience to disease and susceptibility to kidney disorders. Given the increasing prevalence of kidney-related diseases globally and the significant impact of APOL1 variants in specific demographics, scientists are focusing on recombinant protein studies to explore the mechanistic pathways of APOL1 in cellular contexts. Investigating APOL1 as a recombinant protein allows researchers to study its structural properties, interaction with cellular components, and its role in cellular stress responses and kidney pathophysiology. Such studies are essential for developing targeted therapies and interventions aimed at mitigating the adverse effects of APOL1 variants in susceptible populations.











