Analytical Data
-
Gene name
SMN1
- Application
-
Alternative Names
SMN1；SMN；SMNT；SMN2；Survival motor neuron Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16637
-
Expression Region
1-282aa
-
AA Sequence
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASF KHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSA IWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVAN NIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPM PGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPIC PDSLDDADALGSMLISWYMSGYHTGYYMEMLA
-
Molecular Weight
57 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of SMN1 (Survival of Motor Neuron 1) recombinant protein is pivotal due to its essential role in spinal muscular atrophy (SMA), a genetic neurodegenerative disorder characterized by the loss of motor neurons in the spinal cord. The SMN1 gene is responsible for producing the SMN protein, crucial for the survival and function of motor neurons. Mutations or deletions in SMN1 lead to significantly reduced levels of this protein, resulting in the development of SMA and associated muscle weakness. Understanding the structure and function of the SMN protein is critical for developing targeted therapies. Recombinant SMN1 proteins serve as valuable tools in various research applications, including drug screening, the elucidation of molecular mechanisms underlying SMA, and evaluating the efficacy of therapeutic approaches, such as gene therapy and small molecules aimed at increasing SMN protein levels. Advances in protein production technologies enable the generation of high-purity SMN1 recombinant proteins, facilitating in vitro and in vivo studies that contribute to the design of innovative treatments for SMA. Overall, the research on SMN1 recombinant protein not only enhances our understanding of SMA pathophysiology but also opens new avenues for therapeutic interventions, offering hope for affected individuals and their families.
