Analytical Data
-
Gene name
PXR
- Application
-
Alternative Names
PXR；PXR；Nuclear receptor subfamily 1 group I member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75469
-
Expression Region
1-434aa
-
AA Sequence
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
-
Molecular Weight
69.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PXR (Pregnane X Receptor) is a nuclear receptor that plays a crucial role in the regulation of xenobiotic metabolism and drug detoxification processes in the liver. Initially identified as a receptor activated by steroid hormones, PXR has garnered significant attention due to its ability to modulate the expression of various drug-metabolizing enzymes, particularly cytochrome P450 isoforms, and transport proteins. The relevance of PXR in pharmacology is underscored by its involvement in drug-drug interactions and variable drug responses among individuals. Research into PXR has expanded to include its potential role in diseases such as liver disorders, cancer, and metabolic syndromes. Moreover, PXR is also being explored as a therapeutic target to enhance drug efficacy and minimize adverse effects through its modulation. The development of recombinant PXR proteins for structural and functional studies has provided valuable insights into its ligand-binding mechanisms and the downstream signaling pathways it influences. These recombinant proteins serve as essential tools for understanding PXR's interactions with various ligands and for screening potential agonists or antagonists, thereby contributing to the advancement of personalized medicine and improving therapeutic strategies involving drugs that undergo PXR-mediated metabolism. Overall, the ongoing research into PXR and its recombinant proteins is pivotal for uncovering novel insights into drug metabolism and the pharmacological implications associated with this important nuclear receptor.
