Analytical Data
-
Gene name
FNDC4
- Application
-
Alternative Names
Fibronectin type III domain containing 4; Fibronectin type III domain containing protein 4; Fibronectin type III domain-containing protein 4; Fibronectin type III repeat containing protein 1; Fibronectin type III repeat-containing protein 1; FLJ22362; FNDC 4; FNDC4; FNDC4_HUMAN; FRCP 1; FRCP1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6D8
-
Expression Region
1-234aa
-
AA Sequence
MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV
-
Molecular Weight
51.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FNDC4 (fibronectin type III domain-containing protein 4) is a member of the fibronectin type III domain-containing protein family, which plays a critical role in cellular processes such as adhesion, migration, and differentiation. Recent research has increasingly focused on FNDC4 due to its potential involvement in metabolic regulation and tissue homeostasis. Emerging studies suggest that FNDC4 may act as an important mediator in various physiological and pathological conditions, including obesity, type 2 diabetes, and inflammation. Its expression has been linked to the regulation of energy metabolism and insulin sensitivity, making it a compelling target for therapeutic intervention. Additionally, FNDC4 is considered a candidate molecule for studying intercellular signaling pathways that influence metabolic health. Recombinant FNDC4 protein, produced using advanced biotechnological methods, has become a valuable tool for elucidating the molecular mechanisms underlying its biological functions. Through the investigation of FNDC4's structure, interactions, and functional roles, researchers aim to uncover its potential as a biomarker or therapeutic agent for metabolic disorders. The understanding of FNDC4's mechanisms can contribute to the development of novel strategies for managing diseases associated with metabolic dysregulation, thereby advancing our knowledge in the field of endocrinology and metabolic research.
