Analytical Data
-
Gene name
AUP1
- Application
-
Alternative Names
AUP1；Lipid droplet-regulating VLDL assembly factor AUP1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y679
-
Expression Region
1-410aa
-
AA Sequence
MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVLRRFVVRTMCAVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTPLLNSPPSFVCWSRGFMEMNGRGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPTASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AUP1, a gene associated with various biological processes, has garnered attention in recent years due to its potential implications in cellular functions and disease mechanisms. Initially identified in studies related to apoptosis and cell survival, AUP1 has demonstrated a role in regulating mitochondrial dynamics and oxidative stress responses. Research indicates that AUP1 might be involved in critical signaling pathways, influencing cellular proliferation and differentiation. The recombinant protein of AUP1 has become a focal point for investigating its functional properties, providing insights into its interaction with other proteins and its influence on metabolic pathways. Given the rising interest in mitochondrial function and its correlation with neurodegenerative diseases, cancer, and metabolic disorders, the study of AUP1 and its recombinant protein presents an opportunity to explore novel therapeutic targets. Furthermore, AUP1's role in cellular homeostasis underscores the importance of understanding its structural and functional characteristics. As researchers delve deeper into the mechanisms by which AUP1 operates within the cell, the potential for developing innovative treatment strategies to mitigate disease pathology becomes increasingly promising.
