Analytical Data
-
Gene name
FMO4
- Application
-
Alternative Names
FMO4; FMO2; Dimethylaniline monooxygenase [N-oxide-forming] 4; Dimethylaniline oxidase 4; Hepatic flavin-containing monooxygenase 4; FMO 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31512
-
Expression Region
206-301aa
-
AA Sequence
TAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCCSFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKTS
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FMO4 (Flavin-containing monooxygenase 4) is an enzyme belonging to the flavin-containing monooxygenases family, which plays a crucial role in the metabolism of various xenobiotics and endogenous compounds. Research on FMO4 has gained significance due to its involvement in drug metabolism, as it converts nucleophilic compounds into less toxic metabolites through oxidative reactions. Variations in the expression and activity of FMO4 have been linked to individual differences in drug efficacy and toxicity, making it a focal point in pharmacogenomics. Additionally, FMO4 is implicated in the metabolism of dietary substances and neurotransmitters, further underscoring its importance in human health and disease. Understanding the structure and function of FMO4, particularly through recombinant protein studies, allows researchers to explore its catalytic mechanisms and interactions with drug substrates. This research holds promise for optimizing therapeutic strategies and mitigating adverse drug reactions by elucidating individual metabolic profiles influenced by FMO4 activity. As the understanding of FMO4 continues to expand, it may also provide insights into its potential role in various disease states and contribute to the development of personalized medicine approaches.
