Analytical Data
-
Gene name
MIP3b
- Application
-
Alternative Names
MIP3b；GRO3；GROG；SCYB3；C-X-C motif chemokine 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99731
-
Expression Region
22-98aa
-
AA Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLC APPDQPWVERIIQRLQRTSAKMKRRSS
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MIP3b, also known as CCL19, is a chemokine belonging to the CC chemokine family and plays a crucial role in immune system function, particularly in the migration and activation of T cells and dendritic cells. Its significance lies in its ability to attract these immune cells to sites of inflammation and lymphoid tissues, facilitating immune responses. Research on MIP3b has gained considerable attention due to its potential implications in various diseases, including autoimmune disorders, cancer, and infectious diseases. The recombinant MIP3b protein is produced for both basic research and therapeutic applications, allowing scientists to study its interactions with specific receptors and its biological effects on immune cell behavior. This protein can be used in vitro to elucidate the molecular mechanisms underlying immune responses, as well as in vivo to assess its therapeutic potential in modulating immune responses. Understanding the structure and function of MIP3b can contribute to the development of novel therapeutic strategies aimed at enhancing immune responses or controlling inappropriate inflammatory reactions. The continued investigation into the properties of recombinant MIP3b is essential for expanding our knowledge of immune regulation and improving treatment options for various immunological conditions.
