Analytical Data
-
Gene name
IHH
- Application
-
Alternative Names
IHH；Indian hedgehog Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14623
-
Expression Region
29-202aa
-
AA Sequence
IIGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSE RFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVK LRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFD WVYYESKAHVHCSVKSEHSAAAKTGG
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of IHH (Indian Hedgehog) recombinant protein has garnered significant attention in the field of developmental biology and medicine due to its crucial role in cellular signaling pathways, particularly during embryonic development and tissue regeneration. IHH is part of the Hedgehog family of proteins, which are vital for regulating cell growth, differentiation, and pattern formation in various organisms. Dysregulation of IHH signaling has been linked to several diseases, including cancers and congenital disorders. Researchers are particularly interested in understanding the molecular mechanisms governing IHH's function, as this knowledge could lead to novel therapeutic approaches for conditions linked to aberrant Hedgehog signaling. By utilizing recombinant DNA technology, scientists are able to produce IHH in vitro, allowing for detailed studies on its structure, function, and interactions with other cellular components. The investigation of IHH recombinant proteins not only enhances our understanding of critical developmental processes but also provides a platform for exploring potential drug development strategies targeting Hedgehog-related pathways in disease contexts. Moreover, advancements in protein engineering and characterization techniques are enabling researchers to design more effective inhibitors or activators of the IHH signaling pathway, paving the way for innovative treatments in regenerative medicine and oncology.
