Analytical Data
-
Gene name
AOX1
- Application
-
Alternative Names
AOX1;AO;Aldehyde oxidase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q06278
-
Expression Region
236-421aa
-
AA Sequence
FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK
-
Molecular Weight
24.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AOX1, or alternative oxidase 1, is a pivotal enzyme involved in the alternative respiratory pathway in plants, fungi, and some protozoa. It plays a critical role in dissipating excess reducing equivalents during metabolic processes, particularly when traditional pathways are overwhelmed, such as under stress conditions or in response to environmental challenges. The study of AOX1 recombinants has gained attention due to its potential applications in improving stress tolerance in crops, enhancing bioenergy production, and mitigating oxidative stress-related damages. Research has demonstrated that manipulating AOX1 expression can lead to increased resistance to abiotic stresses like drought, salt, and high temperatures, as well as improved overall plant health. Moreover, understanding the structural and functional characteristics of AOX1 at the molecular level can provide insights into its regulation and interaction with other metabolic pathways. As a result, the recombination of AOX1 has become a focus of biotechnological innovations aimed at developing resilient agricultural systems and optimizing energy conversion processes in bioenergy applications. Overall, the exploration of AOX1 recombined proteins holds promise for advancing our understanding of respiratory mechanisms and enhancing plant performance under adverse conditions, ultimately contributing to sustainable agriculture and renewable energy solutions.











