Analytical Data
-
Gene name
TRAIL
- Application
-
Alternative Names
TRAIL；DCR1；LIT；TRAILR3；Tumor necrosis factor receptor superfamily member 10C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50591
-
Expression Region
95-281aa
-
AA Sequence
TSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNE KALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQE EIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQ GGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRAIL (TNF-related apoptosis-inducing ligand) is a member of the tumor necrosis factor (TNF) superfamily that has garnered significant attention in cancer research due to its unique ability to selectively induce apoptosis in cancer cells while sparing normal cells. The quest for effective cancer therapies has led to the exploration of TRAIL and its receptors, as they represent a promising avenue for targeted cancer treatment. Researchers have focused on the production of TRAIL recombinant proteins to study their therapeutic potential and mechanisms of action. The use of recombinant DNA technology has enabled the generation of TRAIL variants with enhanced stability and efficacy, leading to improved apoptotic signaling in various cancer types. Additionally, studies have examined the synergistic effects of TRAIL in combination with other therapeutic agents, further highlighting its potential in overcoming tumor resistance. Investigating the structural properties and biological functions of TRAIL has been crucial in optimizing its design for clinical applications. As research progresses, the development of TRAIL-based therapies holds promise for offering new strategies in personalized cancer treatment, fostering hope for improved outcomes in patients afflicted with malignancies.
