Analytical Data
-
Gene name
TNFSF12
- Application
-
Alternative Names
TNFSF12；APO3L；DR3LG；Tumor necrosis factor ligand superfamily member 12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43508
-
Expression Region
93-249aa
-
AA Sequence
RSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSS PLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCL EEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTY FGLFQVH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFSF12, also known as Tumor Necrosis Factor Superfamily Member 12 or Apo3L, is a cytokine that plays a crucial role in immune regulation and inflammation. Research into TNFSF12 has gained momentum due to its involvement in various pathological conditions, including autoimmune diseases, cancer, and metabolic disorders. This protein acts through its receptor, TNFRSF25, to promote cell survival, proliferation, and the activation of various immune cells, highlighting its potential as a therapeutic target. Scientists are particularly interested in understanding the molecular mechanisms behind TNFSF12's actions, exploring its role in maintaining immune homeostasis and its potential in enhancing antitumor immunity. With the ongoing advancements in recombinant protein technologies, the production of TNFSF12 in a laboratory setting allows for detailed functional analysis and the development of novel treatments. Investigations into the structure and function of TNFSF12 are essential for elucidating its signaling pathways and therapeutic applications, potentially leading to innovative strategies for modulating immune responses in diseases such as cancer and autoimmune disorders. Overall, this area of research holds promise for uncovering new insights into immune system regulation and improving therapeutic interventions.
