Analytical Data
-
Gene name
TP53
- Application
-
Alternative Names
TP53；TP53-binding Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04637
-
Expression Region
1-393aa
-
AA Sequence
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD
-
Molecular Weight
45.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TP53 is a crucial tumor suppressor gene known for its role in regulating the cell cycle, maintaining genomic stability, and preventing tumor formation. The TP53 protein, also known as p53, acts as a transcription factor that activates DNA repair proteins when DNA is damaged, initiates apoptosis in response to severe damage, and ensures that cells with mutations do not proliferate. Given its pivotal role in cancer biology, TP53 has garnered significant attention in research, particularly regarding its mutations and their implications in various cancers. Mutations in the TP53 gene are among the most common genetic alterations in human tumors, leading to a dysfunctional p53 protein that can no longer effectively regulate cell growth and death, resulting in uncontrolled cell proliferation. Research has focused on the development of recombinant TP53 proteins to study their structure-function relationships, therapeutic applications, and role in cancer pathogenesis. These recombinant proteins help in elucidating the pathways by which TP53 exerts its tumor-suppressive functions and provide a platform for designing targeted therapies that can reactivate mutant p53 or mimic its function. Moreover, the understanding gained from studies involving recombinant TP53 proteins has potential implications for personalized medicine approaches in oncology, making it an area of intense scientific inquiry. Understanding the nuances of TP53 structure and function continues to be a critical aspect of cancer research, with implications for diagnosis, treatment, and prognosis of various malignancies.
