Cat: PA1000-8755

Recombinant Human CETP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CETP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CETP;Cholesteryl ester transfer Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11597

  • Expression Region

    1-493aa

  • AA Sequence

    MLAATVLTLALLGNAHACSKGTSHEAGIVCRITKPALLVLNHETAKVIQT AFQRASYPDITGEKAMMLLGQVKYGLHNIQISHLSIASSQVELVEAKSID VSIQNVSVVFKGTLKYGYTTAWWLGIDQSIDFEIDSAIDLQINTQLTCDS GRVRTDAPDCYLSFHKLLLHLQGEREPGWIKQLFTNFISFTLKLVLKGQI CKEINVISNIMADFVQTRAASILSDGDIGVDISLTGDPVITASYLESHHK GHFIYKNVSEDLPLPTFSPTLLGDSRMLYFWFSERVFHSLAKVAFQDGRL MLSLMGDEFKAVLETWGFNTNQEIFQEVVGGFPSQAQVTVHCLKMPKISC QNKGVVVNSSVMVKFLFPRPDQQHSVAYTFEEDIVTTVQASYSKKKLFLS LLDFQITPKTVSNLTESSSESIQSFLQSMITAVGIPEVTSRLEVVFTALM NSKGVSLFDIINPEIITRDGFLLLQMDFGFPEHLLVDFLQSLS

  • Molecular Weight

    80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CETP (Cholesteryl Ester Transfer Protein) is a key protein involved in lipid metabolism, specifically in the transfer of cholesteryl esters and triglycerides between lipoproteins. It plays a critical role in regulating cholesterol levels and is thus of great interest in cardiovascular research, particularly in relation to atherosclerosis and cardiovascular diseases. Studies have shown that variations in CETP activity can influence plasma lipid profiles and are associated with variations in cardiovascular risk. Given its central role in lipid transport and its potential as a therapeutic target, understanding the structure and function of CETP is crucial. Recombining CETP via recombinant DNA technology allows researchers to study its functionality in detail, enabling insights into its role in lipid metabolism and its potential implications for drug development. The production of recombinant CETP facilitates the exploration of its molecular mechanisms, interaction with other lipoproteins, and how it can be manipulated to improve lipid profiles in individuals at risk for heart disease. Thus, research on recombinant CETP is pivotal for elucidating its function and exploring new therapeutic strategies to manage dyslipidemia and reduce cardiovascular risks. Through advanced biotechnological methods and structural biology, the investigation of CETP continues to enhance our understanding of lipid metabolism and its broader implications for public health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US