Analytical Data
-
Gene name
MCHR1
- Application
-
Alternative Names
MCHR1；GPR24；SLC1；Melanin-concentrating hormone receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99705
-
Expression Region
1-353aa
-
AA Sequence
MDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MCHR1, or melanin-concentrating hormone receptor 1, is a G protein-coupled receptor that plays a significant role in regulating various physiological processes, including food intake, energy homeostasis, and sleep patterns. Research into MCHR1 has increased due to its potential implications in obesity and metabolic disorders, where dysregulation of this receptor may contribute to excessive appetite and weight gain. The interest in MCHR1 is also driven by findings that indicate its involvement in the modulation of emotional behaviors and stress responses. Recombinant MCHR1 proteins are essential for studying the receptor's structure, function, and interaction with various ligands, facilitating the discovery of novel pharmacological agents that could target MCHR1 for therapeutic purposes. By utilizing recombinant DNA technology, researchers can produce MCHR1 in heterologous expression systems, allowing for detailed biochemical and pharmacological analyses. Understanding the molecular dynamics and signaling pathways associated with MCHR1 could lead to the development of innovative treatments for obesity and related metabolic disorders, making the study of this receptor increasingly relevant in the fields of pharmacology and biomedical research.
