Cat: PAX2000-12396

Recombinant Human UPK1B Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UPK1B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    UPK1B; TSPAN2; Uroplakin-1b; UP1b; Tetraspanin-20; Tspan-20; Uroplakin Ib; UPIb

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75841

  • Expression Region

    131-228 aa

  • AA Sequence

    NNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR

  • Molecular Weight

    36.52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UPK1B (Uroplakin 1B) is a member of the uroplakin family, which plays a crucial role in forming the urothelial barrier in the bladder. This protein is predominantly expressed in the superficial cells of the urothelium and is involved in maintaining membrane integrity and urinary tract homeostasis. Research into UPK1B has garnered attention due to its implications in bladder function and pathology, including its potential role in bladder cancer. The expression levels of UPK1B can be altered in various urological conditions, providing a possible biomarker for disease diagnosis and progression. Moreover, studies have indicated that UPK1B may influence cellular signaling pathways and contribute to the regulation of cell proliferation and apoptosis within the bladder epithelium. As a result, recombinant UPK1B protein has become a subject of interest for further investigation, enabling researchers to explore its structural properties, interactions, and functional mechanisms in detail. Developing methods for UPK1B protein production can facilitate various studies, including those examining its potential as a therapeutic target or biomarker, as well as its role in bladder tissue engineering. Understanding the molecular characteristics and biological significance of UPK1B is crucial for advancing knowledge in urology and enhancing treatment strategies for bladder-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US