Analytical Data
-
Gene name
UNQ501
- Application
-
Alternative Names
TMEM205; UNQ501/PRO1018; Transmembrane Protein 205
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UW68
-
Expression Region
1-189 aa
-
AA Sequence
MEEGGNLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHISMGCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPRTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL
-
Molecular Weight
47.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UNQ501 is a recombinant protein that has garnered significant interest in the field of biomedicine due to its potential applications in therapeutic and diagnostic contexts. The protein is derived from a specific gene sequence that encodes for a protein involved in various cellular processes, including cell signaling and immune response. Research has shown that UNQ501 exhibits unique structural and functional characteristics that differentiate it from other similar proteins, making it a candidate for further study. The development of recombinant technology has enabled the production of UNQ501 in larger quantities and with higher purity levels, thus facilitating detailed investigations into its biological properties. Initial studies have indicated that UNQ501 may play a role in modulating immune responses, possibly providing insights into the development of novel treatments for autoimmune diseases and infections. Additionally, its potential use as a biomarker for certain conditions is being explored, as early findings suggest that its expression levels might correlate with disease states. Given the increasing importance of targeted therapies and personalized medicine, understanding the functional implications of UNQ501 could lead to significant advancements in therapeutic strategies. Ongoing research aims to elucidate the precise mechanisms by which UNQ501 influences cellular processes and to assess its efficacy and safety in clinical settings. Overall, the study of UNQ501 as a recombinant protein holds promise for both enhancing our understanding of fundamental biological processes and advancing medical innovation.
