Analytical Data
-
Gene name
UNQ3033
- Application
-
Alternative Names
VSTM1; UNQ3033/PRO9835; V-set and transmembrane domain-containing Protein 1; Signal inhibitory receptor on leukocytes-1; SIRL-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UX27
-
Expression Region
1-174 aa
-
AA Sequence
MTAEFLSLLCLGLCLGYEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTIFVAIFSCISILLLFLSVFIIYRCSQHSELRERKGREGE
-
Molecular Weight
46.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UNQ3033 is a recombinant protein that has garnered significant attention in the field of biotechnology and molecular biology due to its potential applications in therapeutic and diagnostic contexts. Originally identified through high-throughput screening methods, this protein is believed to play a crucial role in various cellular processes, including signal transduction and metabolic regulation. The need for further research stems from its unique structural characteristics and possible interactions with specific biological targets, making it a candidate for drug development. Preliminary studies have suggested that UNQ3033 may exhibit beneficial effects in modulating immune responses, offering promising avenues for the treatment of autoimmune disorders and inflammatory diseases. Furthermore, its recombinant nature facilitates large-scale production, allowing for extensive in vitro and in vivo testing. As researchers delve deeper into the functionalities and mechanisms of action of UNQ3033, understanding its structure-function relationship could unlock novel therapeutic strategies. This research not only contributes to the elucidation of complex biological pathways but also holds the promise of advancing personalized medicine, ultimately improving patient outcomes. The continued investigation of UNQ3033 is essential for translating basic scientific findings into practical applications, emphasizing the importance of interdisciplinary approaches in modern biomedical research.
