Analytical Data
-
Gene name
UNQ1912
- Application
-
Alternative Names
F174A_HUMAN; FAM174A; HCV NS5A-transactivated Protein 6; Hepatitis C virus NS5A-transactivated Protein 6; Membrane Protein FAM174A; NS5ATP6; RGD1309973; TMEM157; Transmembrane Protein 157; UNQ1912/PRO4371
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBP5
-
Expression Region
1-190 aa
-
AA Sequence
MKASQCCCCLSHLLASVLLLLLLPELSGPLAVLLQAAEAAPGLGPPDPRPRTLPPLPPGPTPAQQPGRGLAEAAGPRGSEGGNGSNPVAGLETDDHGGKAGEGSVGGGLAVSPNPGDKPMTQRALTVLMVVSGAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR
-
Molecular Weight
46.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UNQ1912 is a recombinant protein that has garnered significant attention in the field of biomedical research due to its potential therapeutic applications. The growing prevalence of various diseases, including autoimmune disorders and cancers, has driven scientists to explore novel protein-based interventions. UNQ1912, derived from a unique sequence identified through advanced genomic analysis, has shown promise in modulating immune responses and influencing cellular pathways. Initial studies suggest that UNQ1912 may play a critical role in enhancing the efficacy of existing treatments by targeting specific molecular mechanisms. Researchers are particularly interested in its ability to interact with biomarkers associated with disease progression, making it a valuable candidate for further investigation. The recombinant nature of UNQ1912 allows for scalable production and precise modification, facilitating detailed studies on its pharmacokinetics and bioactivity. As the quest for innovative therapies continues, exploring the potential of UNQ1912 could lead to breakthroughs in personalized medicine, offering new hope for patients with currently challenging health conditions.
