Analytical Data
-
Gene name
FLYWCH2
- Application
-
Alternative Names
FLYWCH family member 2; Flywch2; FWCH2_HUMAN; OTTHUMP00000159209
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96CP2
-
Expression Region
1-140aa
-
AA Sequence
MPLPEPSEQEGESVKASQEPSPKPGTEVIPAAPRKPRKFSKLVLLTASKDSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL
-
Molecular Weight
15.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FLYWCH2 recombinant protein research focuses on understanding the role of the FLYWCH2 gene, which encodes a protein involved in various cellular processes, such as gene expression regulation and chromatin remodeling. This gene is particularly interesting due to its implications in developmental biology and potential links to diseases, including certain cancers and genetic disorders. Recent studies have highlighted the significance of FLYWCH2 in processes like cell proliferation, differentiation, and apoptosis, suggesting its importance in maintaining cellular homeostasis. Researchers utilize recombinant DNA technology to produce FLYWCH2 protein, allowing for detailed biochemical and structural analyses. By expressing and purifying this protein, scientists aim to investigate its functional mechanisms and interactions with other cellular components. Moreover, understanding FLYWCH2's role could pave the way for therapeutic advancements, as targeting its pathways may offer new strategies for treating related conditions. As such, the study of FLYWCH2 recombinant protein holds promise for both basic biology and clinical applications, providing insights into fundamental processes that govern cell behavior and the potential for innovative treatments in genetic and acquired diseases.
