Analytical Data
-
Gene name
ATF6
- Application
-
Alternative Names
ATF6；Cyclic AMP-dependent transcription factor ATF-6 alpha
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18850
-
Expression Region
1-202aa
-
AA Sequence
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAAN ETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSY SVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPP QT
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The ATF6 (Activating Transcription Factor 6) protein is a key player in the unfolded protein response (UPR), a cellular stress response to the accumulation of misfolded proteins in the endoplasmic reticulum (ER). Upon ER stress, ATF6 is transported to the Golgi apparatus, where it undergoes proteolytic cleavage, resulting in the release of its active form. This active form translocates to the nucleus to initiate the transcription of genes that help restore ER homeostasis, such as those involved in protein folding, degradation, and lipid metabolism. Research into the recombinant ATF6 protein has gained prominence due to its potential implications in various diseases, including neurodegenerative disorders, diabetes, and cancer, where ER stress plays a pivotal role. Understanding ATF6's function and regulation may unveil novel therapeutic strategies to alleviate ER stress-related pathologies. Additionally, producing recombinant ATF6 allows for in-depth studies on its biochemical properties and interactions with other proteins, which is crucial for elucidating its role within the UPR. Recent advances in protein engineering and expression systems have facilitated the efficient production and characterization of recombinant ATF6, paving the way for significant insights into its molecular mechanisms and therapeutic applications.
