Analytical Data
-
Gene name
TNP1
- Application
-
Alternative Names
TNP1；KPNB2；MIP1；TRN；Transportin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09430
-
Expression Region
2-55aa
-
AA Sequence
STSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNP1, or testis-expressed gene 2 protein, is a member of the transition protein family that plays a crucial role in sperm maturation and chromatin remodeling during spermatogenesis. The research on TNP1 recombinant protein has gained significant attention due to its potential implications in male fertility and reproductive health. TNP1 is primarily expressed in the testes and is involved in the packing of sperm DNA by replacing histones with transition proteins, thus facilitating the condensation of chromatin during sperm development. Investigating TNP1's structure and function can provide insights into the molecular mechanisms underlying spermatogenesis and may uncover potential biomarkers for male infertility. Furthermore, recombinant TNP1 can serve as a tool for studying the regulatory pathways of sperm development and exploring therapeutic targets for reproductive disorders. Understanding TNP1’s role opens avenues for developing interventions to combat infertility issues and enhances the knowledge of the complex processes governing testicular function and sperm production. Researchers are focusing on the expression systems for producing functional TNP1 in vitro, which could lead to advancements in fertility treatments and reproductive technologies.
