Analytical Data
-
Gene name
FLJ90650
- Application
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6Q4G3
-
Expression Region
1-198aa
-
AA Sequence
MKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQDDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKNRTLLTSNDTWIVPILWIKNGTTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRVNYDKLGWKKLNQQLEKDPKMR
-
Molecular Weight
49.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The FLJ90650 recombinant protein, also known as an uncharacterized human protein, has attracted attention in biomedical research due to its potential roles in various cellular processes. Initially identified through genome sequencing efforts, FLJ90650 is encoded by a gene located on chromosome 20q13.31, a region that has been implicated in several cancers and other diseases. Despite its identification, the functional characterization of FLJ90650 remains limited, prompting researchers to investigate its biological roles, interactions, and possible implications in health and disease. Preliminary studies suggest that FLJ90650 might be involved in key pathways such as cellular signaling and metabolic regulation, making it a candidate for further functional analyses. Researchers are utilizing recombinant DNA technology to produce the FLJ90650 protein in vitro, allowing for the exploration of its structure and function. Understanding the molecular mechanisms underlying FLJ90650’s action may pave the way for novel therapeutic targets and biomarkers, particularly in oncology and metabolic disorders. This ongoing research reflects the importance of characterizing unannotated proteins in order to elucidate their roles in human biology and pathology.
