Analytical Data
-
Gene name
UNC5C
- Application
-
Alternative Names
UNC5C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95185-2
-
Expression Region
61-270 aa
-
AA Sequence
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSVGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS
-
Molecular Weight
103.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UNC5C, a member of the UNC5 family of netrin receptors, plays a crucial role in neural development and function, primarily known for its involvement in regulating neuronal apoptosis, axon guidance, and synaptic plasticity. It is a transmembrane receptor that interacts with netrin-1 and other ligands, influencing the direction of neuronal growth and survival. Recent studies suggest that UNC5C may also have implications in various diseases, including cancer and neurodegenerative disorders. Understanding the structure and function of UNC5C is vital for the development of potential therapeutic strategies targeting these conditions. As a result, researchers have been focusing on the production of recombinant UNC5C proteins to study their molecular mechanisms and relationships with other signaling pathways. The recombinant forms allow for in-depth analyses of receptor-ligand interactions, downstream signaling cascades, and the effects on cell behavior. Moreover, exploring the structural features of UNC5C through techniques such as X-ray crystallography and NMR can provide insights into its functional dynamics and inform drug development efforts. Overall, the study of UNC5C recombinant proteins is significantly contributing to our understanding of neurobiology and the potential therapeutic interventions in associated pathologies.
