Analytical Data
-
Gene name
FLJ36180
- Application
-
Alternative Names
EC 6.3.2.-; FLJ36180; MGC138638; MGC138639; Probable E3 ubiquitin-protein ligase TRIML1; RING finger protein 209; RNF209
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N9V2
-
Expression Region
1-192aa
-
AA Sequence
MKEMLRKFSTEITLDPATANAYLVLSEDLKSVKYGGSRQQLPDNPERFDQSATVLGTQIFTSGRHYWEVEVGNKTEWEVGICKDSVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAFYNGTDESLIYSFPQASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV
-
Molecular Weight
47.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FLJ36180, also known as the hypothetical protein encoded by the FLJ36180 gene, has garnered interest in the field of molecular biology and protein research due to its potential role in various biological processes. Identified through various genomic and proteomic studies, this protein remains poorly characterized, prompting scientists to investigate its structure, function, and involvement in cellular mechanisms. Preliminary studies indicate that FLJ36180 may be implicated in signaling pathways, cellular regulation, or disease processes, particularly in cancer and other pathologies where its expression levels may vary. Understanding FLJ36180 could provide insights into its functional significance and potential as a biomarker or therapeutic target. Ongoing research involves recombinant expression of FLJ36180 to investigate its biochemical properties, interactions with other proteins, and functional assays in different cellular contexts. By elucidating its role, researchers aim to bridge the gap in our knowledge regarding this enigmatic protein, paving the way for future studies that could unravel its contributions to health and disease at the molecular level.
