Analytical Data
-
Gene name
FLJ30934
- Application
-
Alternative Names
DKFZp761P1320; FLJ30934; MGC42112; MGC57276; Snx32; SNX32_HUMAN; SNX6B; Sortin nexin 32; Sortin nexin 6B; Sorting nexin-32; Sorting nexin-6B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86XE0
-
Expression Region
1-403aa
-
AA Sequence
METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
-
Molecular Weight
72.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant protein FLJ30934 has garnered interest due to its potential implications in various biological processes and therapeutic applications. FLJ30934, also known as C19orf17, was initially identified through genomic sequencing efforts and has been linked to diverse functions within human cells. Investigations into its expression patterns have revealed that it may play a role in cellular signaling, growth, and differentiation, although its exact biological functions remain poorly understood. The protein's unique characteristics and structure make it an intriguing target for research in areas such as cancer biology and metabolic disorders. Furthermore, advances in recombinant DNA technology facilitate the expression and purification of FLJ30934, enabling researchers to study its properties in greater detail. Understanding this protein's mechanisms may open new avenues for drug development, particularly in creating targeted therapies or diagnostic tools. As such, ongoing research aims to elucidate the molecular functions of FLJ30934, assess its interactions within cellular pathways, and evaluate its potential as a biomarker for disease states. This holistic approach could ultimately contribute to a better understanding of its role in human health and disease.
