Analytical Data
-
Gene name
ZNRF1
- Application
-
Alternative Names
E3 ubiquitin-protein ligase ZNRF1. EC:2.3.2.27. Nerve injury-induced gene 283 protein. RING-type E3 ubiquitin transferase ZNRF1. Zinc/RING finger protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8ND25
-
Expression Region
1-227 aa
-
AA Sequence
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
-
Molecular Weight
50.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNRF1 (Zinc and RING finger 1) is an E3 ubiquitin ligase that plays a crucial role in various cellular processes, including cell signaling, differentiation, and apoptosis. The importance of ZNRF1 in developmental biology and cancer has drawn significant attention from researchers. Studies have shown that ZNRF1 is an essential regulator of the Wnt signaling pathway, which is pivotal for stem cell maintenance and tissue homeostasis. Aberrations in Wnt signaling are associated with various cancers, making ZNRF1 a potential therapeutic target. By conducting research on recombinant ZNRF1 proteins, scientists aim to elucidate its structure-function relationship and interaction with substrates and other signaling molecules. Understanding the mechanistic role of ZNRF1 in cellular processes can provide insights into its dual role as a tumor suppressor and oncogene in different contexts. Moreover, generating recombinant ZNRF1 allows for detailed biochemical and biophysical analyses, potentially leading to the development of novel pharmacological agents that can modulate its activity. Overall, the exploration of recombinant ZNRF1 is expected to contribute to the broader understanding of its biological functions and the development of targeted therapies in cancer.
