Cat: PA1000-8587

Recombinant Human NLRP3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NLRP3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NLRP3;C1orf7;CIAS1;NALP3;NACHT. LRR and PYD domains-containing Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96P20

  • Expression Region

    733-1036aa

  • AA Sequence

    LFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW

  • Molecular Weight

    40.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NLRP3, part of the NOD-like receptor (NLR) family, is an intracellular pattern recognition receptor that plays a critical role in the innate immune response. It is best known for its involvement in the formation of the NLRP3 inflammasome, a multi-protein complex that activates caspase-1, leading to the maturation and secretion of pro-inflammatory cytokines such as IL-1β and IL-18. Dysregulation of NLRP3 has been implicated in various inflammatory diseases, including autoimmune disorders, metabolic syndromes, and neurodegenerative diseases, highlighting its potential as a therapeutic target. The study of recombinant NLRP3 proteins has enabled researchers to elucidate the molecular mechanisms governing inflammasome activation and downstream signaling pathways. By examining the structure-function relationship of NLRP3 through recombinant techniques, scientists can develop novel inhibitors or modulators to therapeutically manage conditions associated with NLRP3 dysregulation. Moreover, these studies contribute to a deeper understanding of innate immunity, offering insights into how the immune system recognizes and responds to pathogens and danger signals. As research in this area progresses, the exploitation of NLRP3 as a biomarker for disease prognosis and as a target for drug design continues to gain momentum, potentially leading to innovative strategies for treating inflammation-driven diseases. The recombinant NLRP3 protein will serve as a crucial tool in these ongoing investigations, helping to unravel the complexities of immune responses and paving the way for future therapeutic developments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US