Analytical Data
-
Gene name
UCRC
- Application
-
Alternative Names
UQCR10; UCRC; HSPC119; Cytochrome b-c1 complex subunit 9; Complex III subunit 9; Complex III subunit X; Cytochrome c1 non-heme 7 kDa Protein; Ubiquinol-cytochrome c reductase complex 7.2 kDa Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UDW1
-
Expression Region
1-63 aa
-
AA Sequence
AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
-
Molecular Weight
7.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UCRC (Ubiquitin-C-Terminal Hydrolase L1-Related Protein) is an important protein that has garnered significant attention in recent years due to its crucial role in cellular processes, including protein degradation, DNA repair, and modulation of cancer pathways. The study of UCRC's structure and function provides insights into its potential as a therapeutic target. Research has revealed that UCRC is involved in the ubiquitin-proteasome system, a key mechanism for regulating protein turnover within cells. Dysregulation of this system is implicated in various diseases, notably cancer and neurodegenerative disorders. Therefore, the development of recombinant UCRC proteins allows for a better understanding of its biochemical properties and interactions, paving the way for novel therapeutic strategies. Scientists focus on characterizing the protein's enzymatic activity, identifying potential substrates, and elucidating its role in cell signaling pathways. Moreover, studies on UCRC's involvement in disease models highlight its potential as a biomarker or target for drug development. As research progresses, recombinant UCRC proteins contribute to an enhanced comprehension of ubiquitination processes, ultimately advancing the field of molecular medicine.
