Analytical Data
-
Gene name
FKBP11
- Application
-
Alternative Names
FKBP11; FKBP19; UNQ336/PRO535; Peptidyl-prolyl cis-trans isomerase FKBP11; PPIase FKBP11; 19 kDa FK506-binding protein; 19 kDa FKBP; FKBP-19; FK506-binding protein 11; FKBP-11; Rotamase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYL4
-
Expression Region
1-201aa
-
AA Sequence
MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK
-
Molecular Weight
48.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FKBP11 (FK506-binding protein 11) is a member of the FKBP family of proteins, which are known to possess peptidyl-prolyl isomerase activity and are involved in a variety of cellular processes, including protein folding, cellular signaling, and stress responses. Research into FKBP11 has gained momentum due to its potential role in modulating immune responses and its implications in various diseases, including cancer and neurodegenerative disorders. The protein interacts with several key signaling pathways, making it a point of interest in drug discovery and therapeutic interventions. Advances in recombinant protein technology have facilitated the production of FKBP11 in heterologous systems, allowing for detailed biochemical and structural studies. By studying FKBP11 in the context of its protein partners and biological functions, researchers aim to uncover novel mechanisms of action and therapeutic targets. The exploration of FKBP11 not only enhances our understanding of its biological role but also opens avenues for the development of FKBP11-targeted drugs that could improve treatment strategies for diseases associated with its dysregulation. As such, FKBP11 serves as a critical focus within the fields of molecular biology and pharmacology, bridging the gap between basic research and clinical applications.











