Analytical Data
-
Gene name
ZNF772
- Application
-
Alternative Names
ZNF772; Zinc finger Protein 772
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q68DY9
-
Expression Region
1-489 aa
-
AA Sequence
MAAAEPMGPAQVPMNSEVIVDPIQGQVNFEDVFVYFSQEEWVLLDEAQRLLYRDVMLENFALMASLGHTSFMSHIVASLVMGSEPWVPDWVDMTLAVATETPGGSDPGCWHGMEDEEIPFEQSFSIGMSQIRIPKGGPSTQKAYPCGTCGLVLKDILHLAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPFLLNNCAVQSMEMSFVTGEACKDFLASSSIFEHHAPHNEWKPHSNTKCEEASHCGKRHYKCSECGKTFSRKDSLVQHQRVHTGERPYECGECGKTFSRKPILAQHQRIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKAYSHKSTLVQHESIHTGERPYECSECGKYFGHKYRLIKHWSVHTGARPYECIACGKFFSQSSDLIAHQRVHNGEKPYVCSECGKAFSHKHVLVQHHRIHTGERPYKCSECGKAFRQRASLIRHWKIHTGERP
-
Molecular Weight
80.19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF772 (Zinc Finger Protein 772) is a member of the zinc finger protein family, which plays crucial roles in various biological processes, including gene regulation, cell differentiation, and development. Recent studies have highlighted its potential implications in several diseases, such as cancers and genetic disorders, due to its involvement in transcriptional regulation and chromatin remodeling. The reconstitution of ZNF772 protein provides valuable insights into its functional mechanisms, enabling researchers to investigate its specific binding interactions with DNA and other proteins. Additionally, understanding the post-translational modifications and structural characteristics of ZNF772 can further elucidate its role in cellular pathways. As the demand for therapeutic targets grows, ZNF772 emerges as a promising candidate for drug development and gene therapy due to its regulatory functions. Therefore, research surrounding ZNF772 recombinant protein not only contributes to the fundamental understanding of transcriptional regulation but also opens new avenues for potential medical applications, making it a focal point of interest in molecular biology and biomedicine.
