Cat: PAX2000-12315

Recombinant Human UBE2J1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    UBE2J1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    E2 ubiquitin-conjugating enzyme J1;Non-canonical ubiquitin-conjugating enzyme 1;NCUBE-1;Yeast ubiquitin-conjugating enzyme UBC6 homolog E;HsUBC6e

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y385

  • Expression Region

    1-282 aa

  • AA Sequence

    METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCEGCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHT

  • Molecular Weight

    38.1  kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

UBE2J1, a member of the ubiquitin-conjugating enzyme family, plays a crucial role in the ubiquitination process, which is essential for regulating protein degradation, signaling pathways, and various cellular functions. UBE2J1 is specifically involved in the endoplasmic reticulum-associated degradation (ERAD) pathway, where it facilitates the conjugation of ubiquitin to misfolded or unassembled proteins, leading to their targeted degradation by the proteasome. Abnormalities in UBE2J1 function have been linked to various diseases, including neurodegenerative disorders and cancer, making it a significant target for therapeutic research. Recent studies have focused on the structural and functional characterization of UBE2J1 to elucidate its mechanism of action and interactions with other cellular proteins. The development of recombinant UBE2J1 proteins has enabled researchers to investigate its enzymatic activity and substrate specificity in vitro, providing valuable insights into its role in cellular homeostasis and potential as a drug target. Understanding UBE2J1's functions and regulatory mechanisms could lead to novel strategies for manipulating ubiquitin-mediated pathways in disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US