Analytical Data
-
Gene name
ZNF697
- Application
-
Alternative Names
ZNF697; Zinc finger Protein 697
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TEC3
-
Expression Region
1-136 aa
-
AA Sequence
MCSECGETFSVSSHLFTHKRTHSGERPYVCRECGKGFGRNSHLVNHLRVHTGEKPFRCGQCEKRFSDFSTLTQHQRTHTGEKPYTCIECGKSFIQSSHLIRHRRIHTGNKPHKCAGCGKGFRYKTHLAQHQKLHLC
-
Molecular Weight
42 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF697, a member of the zinc finger protein family, has garnered attention in recent years due to its potential roles in cellular processes such as transcriptional regulation, DNA repair, and cell differentiation. Studies suggest that ZNF697 may be implicated in various diseases, including cancer, owing to its regulatory influence on gene expression and cellular signaling pathways. Researchers aim to explore the structure-function relationship of ZNF697 by developing recombinant protein forms to facilitate detailed investigations into its biochemical properties and functional mechanisms. The production of ZNF697 recombinant protein enables biochemical assays, such as DNA binding studies and protein-protein interaction analyses, which are crucial for elucidating its role in cellular pathways. Understanding ZNF697's precise functionalities could provide insights into its contributions to disease pathology and potentially unveil novel therapeutic targets. As the scientific community continues to delve into the complexities of zinc finger proteins, ZNF697 stands out as a promising candidate for further research aimed at uncovering its biological significance and potential applications in medicine.
