Analytical Data
-
Gene name
ZNF695
- Application
-
Alternative Names
MGC61907 ; RP11-551G24.1; SBZF3; Zinc finger Protein 695; Zinc finger Protein SBZF3; ZN695_HUMAN; ZNF695
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IW36
-
Expression Region
1-133 aa
-
AA Sequence
MGLLAFRDVALEFSPEEWECLDPAQRSLYRDVMLENYRNLISLGEDSFNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSALSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF695, a member of the zinc finger protein family, has garnered significant interest in recent years due to its potential roles in gene regulation and human diseases. This protein is characterized by its zinc finger motifs, which enable it to bind DNA and influence transcriptional activity. Research has suggested that ZNF695 may be involved in key biological processes such as cell differentiation, proliferation, and apoptosis. Abnormal expression of ZNF695 has been linked to various cancers and other pathological conditions, raising questions about its functional mechanisms and regulatory pathways. To better understand the role of ZNF695, efforts have been made to produce recombinant forms of the protein for detailed biochemical and structural analyses. Recombinant ZNF695 can serve as a valuable tool for investigating its interaction with specific DNA sequences and other cellular proteins, thus elucidating its influence in molecular pathways. Furthermore, understanding ZNF695's function could provide insights into the development of targeted therapies for diseases where its dysregulation is implicated. Overall, the study of ZNF695 recombinant protein is pivotal for advancing our knowledge of its biological significance and therapeutic potential.
