Analytical Data
-
Gene name
U2AF1L3
- Application
-
Alternative Names
Splicing factor U2AF 26 kDa subunit. U2 auxiliary factor 26. U2 small nuclear RNA auxiliary factor 1-like Protein 4. U2AF1-like 4. U2(RNU2) small nuclear RNA auxiliary factor 1-like Protein 3. U2 small nuclear RNA auxiliary factor 1-like Protein 3. U2AF1-like Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WU68
-
Expression Region
1-202 aa
-
AA Sequence
MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHVVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM
-
Molecular Weight
48.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
U2AF1L3, a member of the U2AF (U2 small nuclear RNA auxiliary factor) protein family, plays a critical role in the regulation of pre-mRNA splicing by binding to the poly-pyrimidine tract of introns in mRNA precursors. Given its involvement in essential cellular processes, including gene expression and regulation, U2AF1L3 has garnered significant interest in the context of various diseases, particularly cancers. Recent studies have identified mutations in the U2AF1 gene, leading to abnormal splicing events that contribute to tumorigenesis. Moreover, the exploration of U2AF1L3 as a potential therapeutic target is gaining momentum, with researchers investigating its structural characteristics and interactions with other splicing factors. The recombinant protein of U2AF1L3 is crucial for elucidating its biochemical properties and understanding its role in the splicing mechanism. By producing U2AF1L3 in a recombinant form, scientists aim to study its activity in vitro, which could lead to insights into how mutations affect its function and how this, in turn, influences disease progression. Therefore, research on U2AF1L3 and its recombinant protein serves as a vital avenue for uncovering the complexities of RNA processing and identifying potential intervention strategies in splicing-related diseases.
