Cat: PA1000-8540

Recombinant Human NCL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NCL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NCL;Nucleolin

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P19338

  • Expression Region

    2-482aa

  • AA Sequence

    VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQK KGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPA KAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDD DSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDD EEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDE DDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGT EPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGY VDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLP YKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQG TEIDGRSISLYYTGEKGQNQDYRGGKNSTWS

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NCL (Nucleolin) is a multifunctional nucleolar protein that plays a critical role in various cellular processes, including ribosomal RNA synthesis, pre-rRNA processing, and cell proliferation. It is predominantly known for its involvement in the regulation of gene expression and apoptosis, making it a significant focus in cancer research. The study of NCL also extends to its role in various diseases, particularly due to its overexpression in malignant tumors, which has prompted interest in its potential as a therapeutic target. Researchers aim to characterize the structure and function of NCL to better understand its contribution to pathological conditions. Additionally, the reprogramming of protein expression and the manipulation of NCL interactions can uncover new pathways for drug development. By exploring novel recombinant techniques to produce NCL and its variants, scientists hope to facilitate high-throughput screening for small molecules that could inhibit or modulate its function. Understanding the dynamics of NCL not only aids in elucidating its biological significance but also provides insights into how this protein can be leveraged for therapeutic purposes, particularly in oncology, where targeting the dysregulated mechanisms of NCL could lead to innovative treatment strategies. Overall, the investigation of recombinant NCL is crucial for advancing our knowledge of cellular biology and developing new approaches to combat diseases associated with its dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US