Analytical Data
-
Gene name
FBXO7
- Application
-
Alternative Names
FBXO7. FBX7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3I1
-
Expression Region
1-522aa
-
AA Sequence
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSIQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
-
Molecular Weight
84.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXO7 is a member of the F-box protein family, which plays a crucial role in the ubiquitin-proteasome system, regulating protein degradation and cellular processes such as cell cycle progression, signal transduction, and differentiation. Mutations in FBXO7 have been linked to certain neurodegenerative diseases, particularly Parkinson's disease, highlighting its importance in maintaining cellular homeostasis and neuronal health. Research on FBXO7 recombinant protein has gained momentum in recent years, as it serves as a valuable tool for studying its functional roles and regulatory mechanisms in cellular pathways. The expression of FBXO7 in heterologous systems allows scientists to investigate its interactions with substrates and other cellular proteins, as well as its involvement in the ubiquitin-mediated degradation process. Understanding FBXO7's structure-function relationship is essential for deciphering its role in pathological conditions and may reveal potential therapeutic targets. Additionally, the exploration of FBXO7's effects on cellular signaling pathways contributes to the broader understanding of its implications in oncogenesis and neurodegenerative disorders. Through the study of FBXO7 recombinant proteins, researchers aim to illuminate the intricate network of protein interactions and modifications that govern cellular function and to develop innovative strategies for the treatment of diseases associated with FBXO7 dysfunction.
