Analytical Data
-
Gene name
ZNF626
- Application
-
Alternative Names
ZNF626; Zinc finger Protein 626
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q68DY1
-
Expression Region
1-92 aa
-
AA Sequence
MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGITVSKPDLITCLEQGRKPLTMKRNEMIAKPSVSFLQVHSESQSPLHDI
-
Molecular Weight
10.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF626, a member of the zinc finger protein family, has garnered attention in recent years due to its potential role in various biological processes, including transcriptional regulation, signal transduction, and cell differentiation. This protein is characterized by its array of zinc finger motifs, which are implicated in DNA binding and interaction with specific target genes. Research has demonstrated that ZNF626 may be involved in the regulation of genes associated with neurodevelopment and immune responses, making it a key focus in studies related to neurodegenerative diseases and autoimmune disorders. The high expression levels of ZNF626 in certain tissues further underscore its significance in cellular functions and development. Consequently, generating recombinant ZNF626 protein is vital for elucidating its structure-function relationship, understanding its biological mechanisms, and exploring its potential as a therapeutic target. The production of the recombinant protein allows researchers to perform in vitro studies and assays that can clarify how ZNF626 interacts with other proteins and DNA sequences, paving the way for novel insights into its role in health and disease. Overall, the investigation of ZNF626 and its recombinant forms stands to enhance our understanding of genomic regulation and contribute to the development of innovative treatments for related disorders.
