Analytical Data
-
Gene name
FBXO36
- Application
-
Alternative Names
FBXO36; FBX36F-box only protein 36
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NEA4
-
Expression Region
1-188aa
-
AA Sequence
MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIFGARILDYVINFCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP
-
Molecular Weight
48.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXO36 is a member of the F-box protein family, which plays a crucial role in ubiquitin-mediated proteolysis, a key cellular process for protein degradation and turnover. The F-box domain facilitates the interaction with SKP1 and the E3 ubiquitin ligase complex, thus linking substrate proteins to the ubiquitination pathway. FBXO36 is particularly interesting due to its involvement in regulating various biological processes, including cell cycle progression, signal transduction, and maintenance of cellular homeostasis. Recent studies have suggested that dysregulation of FBXO36 may be associated with several diseases, including cancer, where altered protein degradation can lead to the accumulation of oncogenic factors. This makes FBXO36 a potential target for therapeutic intervention. Additionally, understanding the structure and function of FBXO36 and its substrates can provide insights into the molecular mechanisms governing cellular functions and their implications in disease. Given the complex role of ubiquitination in cellular regulation, research on FBXO36 may illuminate new pathways for disease treatment and the development of targeted therapies. Thus, investigating the recombinant expression and functional characterization of FBXO36 is essential to comprehensively understand its role in cell biology and its potential applications in medical research.
