Analytical Data
-
Gene name
BMP15
- Application
-
Alternative Names
BMP15;GDF9B;Bone morphogenetic Protein 15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95972
-
Expression Region
268-392aa
-
AA Sequence
QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
-
Molecular Weight
14.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BMP15 (Bone Morphogenetic Protein 15) is a member of the transforming growth factor-beta (TGF-β) superfamily, primarily expressed in ovarian follicles and playing a crucial role in ovarian function and fertility. Research on BMP15 has gained significance due to its involvement in various reproductive processes, including oocyte maturation, folliculogenesis, and regulation of steroidogenesis. Mutations or dysregulation of BMP15 have been linked to conditions such as premature ovarian insufficiency and infertility in females. The recombinant protein form of BMP15 has been developed for studies aimed at elucidating its biological functions and mechanisms of action in ovarian physiology. By producing BMP15 as a recombinant protein, researchers can investigate its effects on follicular development and oocyte quality in controlled laboratory settings. Additionally, recombinant BMP15 provides a valuable tool for exploring therapeutic applications, potentially addressing fertility issues in humans and livestock. The ability to manipulate BMP15 signaling pathways may lead to novel strategies for enhancing reproductive health and developing targeted treatments for ovarian dysfunction. Overall, the study of recombinant BMP15 is pivotal in advancing our understanding of reproductive biology and may contribute to innovative solutions for infertility.











