Analytical Data
-
Gene name
SREBF1
- Application
-
Alternative Names
SREBF1；BHLHD1；SREBP1；Sterol regulatory element-binding Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36956
-
Expression Region
1-490aa
-
AA Sequence
MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
-
Molecular Weight
54.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SREBF1, or Sterol Regulatory Element-Binding Protein 1, is a key transcription factor that plays a critical role in lipid homeostasis and metabolism. It regulates the expression of genes involved in cholesterol and fatty acid synthesis, making it essential for maintaining cellular lipid levels. Dysregulation of SREBF1 has been associated with various metabolic disorders, including obesity, diabetes, and cardiovascular diseases. Research into the recombinant production of SREBF1 protein has gained importance due to its potential applications in understanding lipid metabolism and developing therapeutic interventions. By studying the structure and function of SREBF1, researchers aim to elucidate the mechanisms underlying its regulatory role in lipid biosynthesis and the impact of its aberrant activity in disease states. The ability to produce SREBF1 as a recombinant protein facilitates experimental investigations, enabling scientists to explore its interactions with other molecules, its post-translational modifications, and its influence on metabolic pathways. Furthermore, as SREBF1 is a pivotal player in the network of regulatory processes responding to nutritional availability and cellular stress, characterizing its function can provide valuable insights into the development of new strategies for treating metabolic syndromes and related conditions.
