Analytical Data
-
Gene name
FBXL8
- Application
-
Alternative Names
FBXL8; FBL8F-box/LRR-repeat protein 8; F-box and leucine-rich repeat protein 8; F-box protein FBL8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96CD0
-
Expression Region
1-374aa
-
AA Sequence
MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA
-
Molecular Weight
66.88 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXL8 is a member of the F-box protein family, which plays a critical role in the ubiquitin-proteasome system by facilitating the ubiquitination process, thus regulating various cellular processes such as cell cycle progression, signal transduction, and protein degradation. Its involvement in these processes has garnered attention, particularly in relation to cancer research, where dysregulation of protein turnover can lead to tumorigenesis. Studies have shown that FBXL8 can influence the stability of key regulatory proteins, impacting signaling pathways that govern cell proliferation and survival. Furthermore, emerging evidence suggests that FBXL8 may contribute to the modulation of cellular responses to stress and the regulation of immune responses. The recombinant expression of FBXL8 protein allows for detailed functional studies and characterization of its interaction with substrates and other cellular factors. Understanding the biochemical properties and biological functions of FBXL8 not only enhances our comprehension of its role in cellular homeostasis but also opens up possibilities for therapeutic applications, as targeting FBXL8 could provide a novel strategy in cancer treatment. Thus, the research on FBXL8 recombinant protein is pivotal in unraveling its functions and potential implications in both health and disease contexts.
