Analytical Data
-
Gene name
ZNF589
- Application
-
Alternative Names
KRAB zinc finger Protein SZF1 1; Stem cell zinc finger Protein 1; SZF1; Zinc finger Protein 589; ZN589_HUMAN; ZNF589; ZNP589
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86UQ0
-
Expression Region
1-364 aa
-
AA Sequence
MWAPREQLLGWTAEALPAKDSAWPWEEKPRYLGPVTFEDVAVLFTEAEWKRLSLEQRNLYKEVMLENLRNLVSLAESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETPGFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVCRECGRGFSRKSQLIIHQRTHTGEKPYVCGECGRGFIVESVLRNHLSTHSGEKPYVCSHCGRGFSCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCRD
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF589, a member of the zinc finger protein family, has gained attention for its potential roles in various biological processes, including gene regulation, cell differentiation, and development. This protein is characterized by its unique structural domains, which enable it to bind to specific DNA sequences, thus influencing transcriptional activity. Recent studies have suggested that ZNF589 may be involved in crucial pathways related to cellular responses to stress and immune regulation, further underscoring its significance in both normal physiological functions and disease states. Despite its importance, the precise mechanisms of ZNF589's action and its potential interactions with other proteins remain poorly understood, prompting researchers to explore its biochemical properties through recombinant protein techniques. The generation of ZNF589 recombinant protein allows for detailed studies on its structure-function relationships, post-translational modifications, and interaction networks. By elucidating these aspects, scientists aim to clarify the role of ZNF589 in human health and disease, paving the way for potential therapeutic applications targeting ZNF589-associated pathways. Ultimately, this research holds promise for expanding our understanding of gene regulation and the molecular underpinnings of disorders linked to zinc finger proteins.
