Analytical Data
-
Gene name
FBXL12
- Application
-
Alternative Names
F box and leucine rich repeat protein 12; F box protein FBL12; F box/LRR repeat protein 12; F-box and leucine-rich repeat protein 12; F-box protein FBL12; F-box/LRR-repeat protein 12; Fbl12; FBXL 12; FBXL12; FLJ20188; FXL12_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NXK8
-
Expression Region
1-326aa
-
AA Sequence
MATLVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLHSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKESMDWWM
-
Molecular Weight
61.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FBXL12, a member of the F-box family, plays a crucial role in regulating protein degradation via the ubiquitin-proteasome pathway. It participates in various cellular processes, including cell cycle progression, apoptosis, and signal transduction, making it a significant focus for research in cancer biology and other diseases. Dysregulation of FBXL12 has been implicated in tumorigenesis and other pathological conditions, underscoring its potential as a therapeutic target. Recent studies have shown that FBXL12 interacts with several important proteins, influencing their stability and function. Consequently, the recombinant expression of FBXL12 in various systems allows researchers to investigate its biochemical properties, interactions, and functional roles in greater detail. By producing FBXL12 as a recombinant protein, scientists can perform in vitro assays, study its mechanism of action, and explore its potential implications in drug development. This research not only enhances our understanding of FBXL12's role in cellular regulation but also opens avenues for targeted therapies that could mitigate diseases associated with its aberrant expression or function. As researchers delve deeper into the molecular pathways involving FBXL12, the findings may contribute to novel strategies for cancer treatment and provide insight into the broader mechanisms of cellular homeostasis and disease.
