Analytical Data
-
Gene name
ZNF545
- Application
-
Alternative Names
Zinc finger Protein 82. Zfp-82. Zinc finger Protein 545
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P9Y7
-
Expression Region
1-532 aa
-
AA Sequence
MALRSVMFSDVSIDFSPEEWEYLDLEQKDLYRDVMLENYSNLVSLGCFISKPDVISSLEQGKEPWKVVRKGRRQYPDLETKYETKKLSLENDIYEINLSQWKIMERIENHGLKGLILKNDWESTGKIEGQERPQEGYFSSVKMPSEKVSSYQKRTSVTPHQRLHFVDKPYECKECGKAFRVRQQLTFHHRIHTGEKPYECKECGMAFRQTAHLTRHQRLHSGEKLYECKECGEAFICGADLRVHQKMHIGEKPYECKECGKAFRVRGQLTLHQRIHTGEKPYVCKECGKAFRQYAHLTRHQKLNSADRLYECKECGKAFLCGSGLRVHHKLHTGEKPYECKECGKAFRVRQQLTLHQRIHTGEKPYECKECGKTFSRGYHLILHHRIHTGEKPYECKECWKAFSRYSQLISHQSIHIGVKPYDCKECGKAFRLLSQLTQHQSIHIGEKPYKCKECGKAFRLRQKLTLHQSIHTGEKPFECKECRKAFRLNSSLIQHLRIHSGEKPYECKECKKAFRQHSHLTHHLKIHNVKI
-
Molecular Weight
89 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF545, a member of the zinc finger protein family, has gained attention in recent years due to its potential roles in gene regulation, differentiation, and tumorigenesis. Research indicates that ZNF545 may participate in crucial biological processes, including cell cycle regulation and apoptosis, leading to interest in its function within cancer and developmental biology. Studies have demonstrated that ZNF545 can influence the expression of various target genes, suggesting it may act as a transcriptional regulator. Moreover, aberrations in the expression levels of ZNF545 have been linked to various malignancies, prompting investigations into its potential as a biomarker for cancer diagnosis and prognosis. As the understanding of ZNF545's molecular mechanisms continues to evolve, recombinant protein studies have become vital to elucidate its structure-function relationships and interaction partners. This is crucial for assessing its therapeutic potential and for designing targeted interventions in diseases where ZNF545 is implicated. The generation of ZNF545 recombinant proteins allows for detailed characterization and functional assays, paving the way for innovative applications in gene therapy and cancer treatment. Overall, the research on ZNF545 recombinant proteins is an important frontier in molecular biology, with significant implications for understanding disease mechanisms and developing novel therapeutic strategies.
